Sign In | Join Free | My atjoomla.com
atjoomla.com
Products
Search by Category
Home > Chemicals > Oxide >

Does Cjc 1295 Work

does cjc 1295 work

All does cjc 1295 work wholesalers & does cjc 1295 work manufacturers come from members. We doesn't provide does cjc 1295 work products or service, please contact them directly and verify their companies info carefully.

Total 2248 products from does cjc 1295 work Manufactures & Suppliers
Buy cheap  product

Brand Name:Hongkong blue

Model Number:CJC-1295 87616-84-0

Place of Origin:CHINA

...87616-84-0 Human Peptides CJC-1295 Freeze-dried Powder For Muscle Gain Why choose hongkong blue company and contact mabel ? Emai:...

HongKong Blue Universal Co., Limited.
Verified Supplier

Hongkong

Buy cheap  product

Brand Name:KANGDISEN

Model Number:2 mg/vial

Place of Origin:China

... Hormone Steroids CJC-1295 Without DAC Peptide Modified GRF (1-29), CJC-1295 no DAC Modified Growth Releasing Factor aminos 1-29, usually referred to as Modified GRF (1-29) or “ModGRF(1-29),” also known as CJC-1295 without...

Hongkong Kangdisen Medical Co., Limited
Verified Supplier

Hong Kong

Buy cheap  product

Brand Name:Pharmlab

Model Number:863288-34-0

Place of Origin:China

...99% Human Growth Peptide CJC-1295 with DAC 2mg CAS 863288-34-0 for Muscle Growth CJC-1295 DAC Quick detail Product Name CJC-1295 With DAC CAS Number 863288-34-0 Molecular Formula C165H269N47O46 Molecular Weight 873...

Pharmlab Co.,Ltd
Verified Supplier

Hubei

Buy cheap  product

Brand Name:wumeitech

Model Number:863288-34-0

Place of Origin:China

.../vial Cjc-1295 with Dac for Fat Burning 2mg/Vial Legal Safe Peptide CJC-1295 Acetate with Dac Muscle Growth Polypeptide Materials Human Growth Hormone Peptide Manufacturer Supply Cjc-1295 Without Dac with Over 98% Purity CJC-1295...

Zhuhai Wumei Technology Co.,ltd.
Verified Supplier

Guangdong

Buy cheap  product

Brand Name:CJC-1295 Without DAC

Model Number:863288-34-0

Place of Origin:China

...High purity legal peptides Steroids CJC-1295 Without DAC​​​ 2mg / Vial , CAS 863288-34-0 Not only has Cjc1295 shown the ability to ...

JCJ Logis Co.,ltd
Verified Supplier

Hubei

Buy cheap  product

Brand Name:HKYC

Model Number:PEPTIDE POWDER

Place of Origin:HUBEI,CHINA

...CJC1295 Human Growth Peptide Steroid Cjc-1295 No Dac for Muscle Enhance CJC 1295 No DAC Basic Info Name CJC 1295 Alias CJC-1295 No DAC, CJC-1295 without DAC,Mod GRF 1-29 CAS 863288-34-0 M. F C152H252N44O42 M. W 3367.2 Purity (HPLC...

Hongkong YuanCheng GongChuang Technology Co.,Ltd
Verified Supplier

Buy cheap  product

Brand Name:LSW

Model Number:CAS:51753-57-2

Place of Origin:China

...Cjc-1295 Peptide Human Growth Steroid Cjc-1295 with Dac for Muscle Enhance with reasonable price and safe delivery Quick Detail: Products Name; CJC 1295 CAS No.: 863288-34-0 Molecular Formula: C165H271N47O46 Molecular Weight: 3649.30...

Wuhan Lianshangwang Technology Co.,LTD
Verified Supplier

Hong Kong

Buy cheap  product

Brand Name:Shuangbojie

Model Number:863288-34-0

Place of Origin:China

...Growth Hormone Muscle Building Peptides CJC 1295 with Dac 2mgvial 1. CJC 1295 DOSES Modified GRF 1-29(cjc1295 w/o DAC): Dose per injection: 100mcg Injections per vial: 20 x 100mcg ...

Zhuhaishi Shuangbojie Technology Co., Ltd
Verified Supplier

Guangdong

Buy cheap  product

Brand Name:Gear Steroids

Model Number:51753-57-2

Place of Origin:China

... 1, Basic Info. Model NO.: Cjc-1295 Customized: Customized Suitable for: Elderly, Adult Purity: >99% MOQ: 1 kit Material: Pharmaceutical Raw Material Reship: Available Usage: for Lean Muscle Shipping Time: 3~7 Working days Specification: USP28 HS...

Shanghai Rong Can Science And Technology Co., Ltd.
Verified Supplier

Shanghai

Buy cheap  product

Brand Name:Grand Uni or OEM

Model Number:CAS:863288-34-0

Place of Origin:China

...-Ile-Leu-Ser-Arg-LysLys(Maleimidopropionyl)-NH2 (Drug Affinity Complex) CJC-1295 Molecular formula: C165H269N47O46 CJC-1295 Molar Mass: 3647.15 CJC-1295 CAS number: 863288-34-0 CJC-1295 is an injectable peptide used to increase GH production.

GRAND UNIVERSE INDUSTRIAL LIMITED
Verified Supplier

Guangdong

Buy cheap  product

Brand Name:Blue Dragon

Model Number:CJC-1295 (Without/ No DAC) 2mg

Place of Origin:China Manufacturer

...CJC-1295 (Without/ No DAC) Profile: Product Name: CJC-1295 Without DAC Specification: 2mg per vial Synonyms: CJC-1295 Acetate; CJC-1295; CJC-1295 No DAC, CJC-1295 W/O DAC, Modified GRF (1-29) CAS No.: 863288-34-0 MF: C152H252N44O42 MW: 3367.97 Sequence...

Zhuhaishi Shuangbojie Technology Co., Ltd.
Verified Supplier

Guangdong

Buy cheap  product

Brand Name:YIHAN

Model Number:CJC -1295

Place of Origin:China

...CJC 1295 Nutrition Fitness Peptide Growth Hormone 2mg / Vial CAS 863288-34-0 CJC-1295 Alias: CJC-1295 Acetate; CJC1295(Without DAC); Sequence: Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-...

Yihan Industrial Co.,Ltd.
Verified Supplier

Hongkong

Buy cheap  product

Brand Name:YC

Model Number:863288-34-0

Place of Origin:China

... name: CJC-1295 Acetate Alias:GHRH, Growth Hormone Releasing Hormones,MOD GRF 1-29 CAS Registry Number: 863288-34-0 Appearance: White Powder Purity:98% Grade: Pharmaceutical Grade Storage: Shading, confined preservation CJC-1295 Effect CJC-1295 is...

Hangzhou Fuluo Biological Technology Co.,Ltd.
Verified Supplier

Zhejiang

Buy cheap  product

Brand Name:Chembj-Steroid

Model Number:CAS: 863288-34-0

Place of Origin:China

...2mg CJC 1295 without DAC CAS: 863288-34-0 Peptide Steroid Hormones CJC 1295 White Powder Quick Detail; Product name: CJC 1295 without DAC/ CJC 1295 DAC CAS: 863288-34-0 Formula: C152H252N44O42 Molecular weight: 3367.2 purity: > 98.0% Appearance: White...

Changsha Zhenxiang Biotechnology Co., Ltd.
Verified Supplier

Hunan

Buy cheap  product

Brand Name:Shanghai Stero

Model Number:CJC 1295 DAC

Place of Origin:China

...Bodybuilding Hormone Supplements Growth Hormone Peptides Injection CJC 1295 DAC Description: CJC-1295 with DAC is a peptide known to help in promoting muscle gain, muscle strength, lean body ...

Shanghai Stero R&D Co,. Ltd
Verified Supplier

Shanghai

Buy cheap  product

Brand Name:JNJG

Model Number:CJC-1295 with DAC

Place of Origin:CHINA

...CJC 1295 DAC Pharma Grade Human Growth Peptides Powder CJC1295 With DAC other name CJC1295dac, CJC1295withDAC Product Description CJC-1295 2mg/Vial Type Immune Function AgentsGrade Standard Medicine Grad Classification Brassinosteroid MF C165H271N47O46 ...

Jinan  Jia  Ge  Biological  Technology  Co., Ltd.
Verified Supplier

Shandong

Buy cheap  product

Brand Name:Nanjian

Model Number:Wuhan2017022

Place of Origin:China

...)-NH2 (Drug Affinity Complex) Molecular formula: C165H269N47O46 Molar Mass: 3647.15 CAS number: 863288-34-0 CJC-1295 is an injectable peptide used to increase GH production. This peptide is a growth hormone

Tai'an Jia Ye Biological Technology Co.,Ltd
Verified Supplier

Buy cheap  product

Brand Name:kafen

Model Number:HGH-Eptifibatide

Place of Origin:Guangzhou,China

...Medicine Grade Drug Human Growth Hormone Peptides CJC 1295 DAC 2 mg / Vial 1 . Introduction other name: CJC1295dac, CJC1295withDAC Product Description: CJC-1295 2mg/Vial Type: Immune Function AgentsGrade Standard: Medicine Grad Classification: ...

Guangzhou Kafen Biotech Co.,Ltd
Verified Supplier

Guangdong

Buy cheap  product

Brand Name:NJBN STEROID

Model Number:863288-34-0

Place of Origin:MADE IN CHINA

...Hot Sell Body Building Peptides CAS 863288-34-0 CJC-1295 for Increase GH Production Quick Detail: Product Name CJC1295 Synonyms CJC1295;Y(d -A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2;L-Tyrosyl-D-alanyl-L-...

Nanjing Bangnuo Biotechnology Co., Ltd
Verified Supplier

Jiangsu

Buy cheap  product

Brand Name:CJC-1295

Model Number:CAS Number 863288-34-0

Place of Origin:China

... analog. That is to say, it works in the same way as GHRH, and may be referred to as being a GHRH. The principal use of CJC-1295 is to provide increased GH levels...

Shenzhen Ghormone Biotech Co.,Ltd
Active Member

Guangdong

Inquiry Cart 0
  • Haven't found right suppliers
  • Our buyer assistants can help you find the most suitable, 100% reliable suppliers from China.
  • And this service is free of charge.
  • we have buyer assistants who speak English, French, Spanish......and we are ready to help you anytime!
  • Submit Buying Request