Sign In | Join Free | My
Search by Category
Home > Agriculture > Animal Extract >

Short Acting Insulins

short acting insulins

All short acting insulins wholesalers & short acting insulins manufacturers come from members. We doesn't provide short acting insulins products or service, please contact them directly and verify their companies info carefully.

Total 513 products from short acting insulins Manufactures & Suppliers
Buy cheap  product

Brand Name:Newlystar

Place of Origin:China

Model Number:300 Units/3 mL, 1000 Units/10 mL

... : one vial/box Description: Insulin glargine [rDNA origin] injection is a sterile solution of insulin glargine for use as a subcutaneous injection. Insulin glargine is a recombinant human insulin analog that is a long-acting (up to 24-hour...

Newlystar (Ningbo) Medtech Co.,Ltd.
Verified Supplier


Buy cheap  product

Brand Name:HKYC

Model Number:196078-30-5

Place of Origin:China

...Pramlintide Acetate Polypeptide Hormones Treating Insulin Dependent Diabetes Polypeptide Amylin Basic Info. Name: Pramlintide Acetate Cas No.: 196078-30-5 Molecular Formula: ...

Hongkong Yuancheng Gongchuang Technology Co., Limited
Verified Supplier

Hong Kong

Buy cheap  product

Brand Name:Uni-pharma

Model Number:R,NPH,30-70,50-50

Place of Origin:CHINA

...Promixed Protamine Recombinant Human (R,NPH,30-70,50-50)/ Recombinant Insulin Glargine Injection anti-diabetics Description: Humulin R (insulin (human recombinant)) U-100 is indicated as an adjunct to diet and exercise to improve...

Wuhan uni-pharma bio-tech co.,ltd
Verified Supplier


Buy cheap  product

Brand Name:kafen

Model Number:946870-92-4

Place of Origin:China

...-1 is basically a polypeptide hormone that has the same some of the same molecular properties as insulin. IGF dose actually stand for insulin-like growth factor. IGF-1 is mainly responsible for long bone

Guangzhou Kafen Biotech Co.,Ltd
Verified Supplier


Buy cheap  product


Model Number:white powder

Place of Origin:China

...: Package: 1kg/Foil bag Appearance:White crystalline powder. Applications: Testosterone Acetate ester is much faster acting than Enathate or

Hongkong Kangdisen Medical Co., Limited
Verified Supplier

Hong Kong

Buy cheap  product

Brand Name:ChineseHormone

Model Number:IGF-1 DES

Place of Origin:China

...) and having a molecular mass of 7368.5 Dalton. IGF-1 Des1-3 is purified by proprietary chromatographic techniques. Insulin-Like Growth Factor-1 DES (1-3): Sequence TLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLK PAKSA

Verified Supplier

Hong Kong

Buy cheap  product

Brand Name:Guangzhou Huao

Model Number:151126-32-8

Place of Origin:Guangzhou China

Hormones Powder Peptides Pramlintide Powder for Hypoglycemic agents 151126-32-8 Name: Pramlintide Acetate Sequence: Cas No.: 196078-30-5 Molecular Formula: C171H267N51O53S2 Molecular Weight: 8949.47 Purity (HPLC): 98.0%min. Appearance: White powder ...

Guangzhou Huao Chemical Co.,Ltd
Verified Supplier


Buy cheap  product

Brand Name:YIJING

Model Number:PEG-MGF

Place of Origin:China

Pharmaceutical Raw Materials Polypeptide PEG-MGF Promote Growth Factor Bodybuilding Product introduction: PEG-MGF ; MGF; MGF,PEG-MGF,peg-mgf, PEGylated,MGF For Mechano M. F: C121H200N42O39 Purity (HPLC): 99.5.0% Single Impurity(HPLC): ≤ 0.5% Amino Acid ...

Shanghai Yijing Pharmaceutical Co.,Ltd
Verified Supplier


Buy cheap  product

Brand Name:steriodshow

Model Number:Skype: racheltao5605

Place of Origin:china manufactuer

Polypeptide Hormones PEG-MGF PEGylated Mechano Growth Factor for Bodybuilding 1. Quick Detail: Unit Size :2 mg/vial Unit Quantity 1 Vial Synonyms :peg MGF,Mechano growth factor,IGF-1 EC Molecular :Formula C121H200N42O39 Molecular Weight :2948.15+(1800-...

Zhuhaishi Shuangbojie Technology Co.,ltd
Verified Supplier


Buy cheap  product

Brand Name:Steroid(Saichuang)

Model Number:99

Place of Origin:China

Bodybuilding Human Growth Peptides PEG-MGF PEGylated Mechano Growth Factor 2 Mg/vial Peg-mgf Injectable Peptide Hormones Bodybuilding PEG-MGF PEGylated Mechano Growth Factor Quick Detail: 2mg*10vial/kit Molecular Formula : C121H200N42O39 Molecular Weight ...

Hongkong  Saichuang  Pharmaceutical  Technology  Co.,Ltd
Verified Supplier


Buy cheap  product

Brand Name:Pharmlab

Model Number:N/A

Place of Origin:China

Injectable Peptides Machano Growth Factor (MGF) White powder for Muscle gaining Quick details: Product Name Mechano Growth Factor (MGF) MF C121H200N42O39 MW 2867.2 Assay min 98% Storage temperture -20°C Usage improving muscle mass Description: Mechano ...

Pharmlab Co.,Ltd
Verified Supplier


Buy cheap  product

Place of Origin:China

Brand Name:YC

Model Number:20161101

Peptide Steroid Hormones PEG MGF Pegylated Mechano Growth Factor Purchase Peptides PEG IGF-1 Sequence: PEG-Tyr-Gln-Pro-Pro-Ser-Thr-Asn-Lys-Asn-Thr-Lys-Ser-Gln-Arg-Arg-Lys-Gly-Ser-Thr-Phe-Glu-Glu-Arg-Lys-NH2 Molecular formula: C121H200N42O39 Molar Mass: ...

Changsha Zhenxiang Biotechnology Co., Ltd.
Verified Supplier


Buy cheap  product

Brand Name:anabolic-oral steroids

Model Number:PEG MGF

Place of Origin:China

Pepties Steroids PEG MGF PEGylated Mechano Growth Factor 2mg/vial for Human Growth PEG MGF PEGylated Mechano Growth Factor PEG MGF is a splice variant of the IGF produced by a frame shift if the IGF gene and PEGylated to improve stability. PEG-MGF, or ...

JCJ Logis Co.,ltd
Verified Supplier


Buy cheap  product

Brand Name:Nanjian

Model Number:PEG-MGF

Place of Origin:China

99% PEG Mechano Growth Factor Peptide Hormone PEG MGF White Powder for muscle building 1.basic info: Alias: PEG-Suc-YQPPSTNKNTKSQ(d)R(d)RKGSTFEEHK-NH2; PEG-Suc-Tyr-Gln-PRO-PRO-Ser-Thr-Asn-Thr-Lys-Ser-Gln-D-Arg-Lys-Gly-Ser-Thr-Phe-Glu-Glu-His-Lys-NH2 M.F.:...

Tai'an Jia Ye Biological Technology Co.,Ltd
Verified Supplier

Buy cheap  product

Brand Name:Pharm


Place of Origin:China

... peptides are the span of the half-life. Modified GRF 1-29 and Sermorelin have a very short acting half-life of about 30 minutes, while CJC-1295 DAC has a

Verified Supplier


Buy cheap  product

Brand Name:wumeitech

Model Number:51022-70-9

Place of Origin:China

... 2 Mg/Vial Raw Powder Purity Peptides Mgf Peg Mgf for Body Growth PEGylation is the act of attaching a Polyethylene glycol (PEG) structure to another larger molecule (in this case, MGF). The...

Zhuhai Wumei Technology Co.,ltd.
Verified Supplier


Buy cheap  product

Brand Name:Sendi

Model Number:Pharmaceutical Grade

Place of Origin:China

... White powder MGF Description MGF Mechano growth factor (MGF) is a novel splice variant of the insulin growth factor -1 (IGF-1), also known as IGF-1Ec in humans and IGF-1Eb in rodents...

Shenzhen Sendi Biotechnology Co.Ltd.
Verified Supplier


Buy cheap  product

Brand Name:Bodybuilding

Model Number:863288-34-0

Place of Origin:China

High Purity Peptide CJC-1295 Without Dac (2mg/Vial) CAS:863288-34-0 Muscle Building Product Descripition: CAS 863288-34-0 Appearance White Powder MF C152H252N44O42 MW 3367.2 Assay >99.5% Single Impurity(HPLC) 1.0% Amino Acid Composition ±10% of ...

Zhuzhou Yuancheng Hezhong Tech & Dev Co., Ltd
Verified Supplier


Buy cheap  product

Brand Name:BOF

Model Number:N/A

Place of Origin:China

98% Assay PEG MGF Peptide Hormones Bodybuilding Human Growth Hormone Steroid​ Quick Detail: Name PEG MGF CAS No. N/A Synonyms Pegylated MGF, PEG Assay >98% Description White powder Molecular Formula C121H200N42O39 Molar Mass 2888.16 Usage Muscles grow ...

Wuhan Biofriend Technology Co.,Ltd
Verified Supplier


Buy cheap  product

Brand Name:HKYC


Place of Origin:HUBEI,CHINA

CJC1295 Human Growth Peptide Steroid Cjc-1295 No Dac for Muscle Enhance CJC 1295 No DAC Basic Info Name CJC 1295 Alias CJC-1295 No DAC, CJC-1295 without DAC,Mod GRF 1-29 CAS 863288-34-0 M. F C152H252N44O42 M. W 3367.2 Purity (HPLC) 98.0%min. Appearance ...

Hongkong YuanCheng GongChuang Technology Co.,Ltd
Verified Supplier

Inquiry Cart 0
  • Haven't found right suppliers
  • Our buyer assistants can help you find the most suitable, 100% reliable suppliers from China.
  • And this service is free of charge.
  • we have buyer assistants who speak English, French, Spanish......and we are ready to help you anytime!
  • Submit Buying Request